SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000156825 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000156825
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000301
Family Methyl-CpG-binding domain, MBD 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSP00000156825
Domain Number - Region: 160-251
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family Clathrin adaptor core protein 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000156825   Gene: ENSG00000071655   Transcript: ENST00000156825
Sequence length 259
Comment pep:known chromosome:GRCh38:19:1573596:1592801:-1 gene:ENSG00000071655 transcript:ENST00000156825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGK
PDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIA
EELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQ
PLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDE
EDEEEEEEEPDPDPEMEHV
Download sequence
Identical sequences A0A2J8J1W3
GO.45272 ENSP00000466670 ENSP00000156825 NP_001268383.1.87134 NP_001268383.1.92137 XP_009432567.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]