SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000205402 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000205402
Domain Number 1 Region: 39-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.47e-62
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000132
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.87e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000205402   Gene: ENSG00000091140   Transcript: ENST00000205402
Sequence length 509
Comment pep:known chromosome:GRCh38:7:107890970:107921203:1 gene:ENSG00000091140 transcript:ENST00000205402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF
Download sequence
Identical sequences A0A024R713 A0A2J8QXX9 P09622
gi|91199540|ref|NP_000099.2| 9606.ENSP00000205402 NP_000099.2.87134 NP_000099.2.92137 ENSP00000205402 ENSP00000390667 ENSPTRP00000033534 ENSP00000205402 ENSP00000390667 ENSP00000205402 ENSPTRP00000033534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]