SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000215368 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000215368
Domain Number 1 Region: 35-175
Classification Level Classification E-value
Superfamily Cupredoxins 4.93e-47
Family Ephrin ectodomain 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000215368   Gene: ENSG00000099617   Transcript: ENST00000215368
Sequence length 213
Comment pep:known chromosome:GRCh38:19:1286154:1300237:1 gene:ENSG00000099617 transcript:ENST00000215368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT
VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP
GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA
PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
Download sequence
Identical sequences A0A2J8J234 A0A2J8R9Q2 O43921
ENSP00000215368 NP_001396.2.87134 NP_001396.2.92137 9606.ENSP00000215368 gi|27894381|ref|NP_001396.2| ENSP00000215368 ENSP00000215368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]