SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000216465 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000216465
Domain Number 1 Region: 88-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.54e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.000000334
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000216465   Gene: ENSG00000100577   Transcript: ENST00000216465
Sequence length 216
Comment pep:known chromosome:GRCh38:14:77320884:77331597:1 gene:ENSG00000100577 transcript:ENST00000216465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
TLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Download sequence
Identical sequences A0A0C4DFM0
ENSP00000216465 9606.ENSP00000216465 NP_665877.1.87134 NP_665877.1.92137 gi|22202624|ref|NP_665877.1| ENSP00000216465 400306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]