SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000219409 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000219409
Domain Number 1 Region: 29-225
Classification Level Classification E-value
Superfamily E set domains 1.4e-69
Family RhoGDI-like 0.000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000219409   Gene: ENSG00000242173   Transcript: ENST00000219409
Sequence length 225
Comment pep:known chromosome:GRCh38:16:280606:283010:1 gene:ENSG00000242173 transcript:ENST00000219409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIR
QLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD
QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFV
TPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Download sequence
Identical sequences F1T0H7 Q99819
ENSP00000408037 9606.ENSP00000219409 NP_001167.2.87134 NP_001167.2.92137 ENSP00000219409 gi|83313661|ref|NP_001167.2| ENSP00000219409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]