SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000221130 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000221130
Domain Number 1 Region: 65-121,148-401
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.09e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000132
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.36e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000221130   Gene: ENSG00000104687   Transcript: ENST00000221130
Sequence length 522
Comment pep:known chromosome:GRCh38:8:30678061:30727926:-1 gene:ENSG00000104687 transcript:ENST00000221130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences P00390 V9HW90
gi|50301238|ref|NP_000628.2| ENSP00000221130 NP_000628.2.87134 NP_000628.2.92137 ENSP00000221130 ENSP00000221130 9606.ENSP00000221130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]