SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000222339 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000222339
Domain Number 1 Region: 837-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 3 Region: 878-930
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.6e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 635-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000209
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 678-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000148
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 555-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000478
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000157
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 8 Region: 453-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000269
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 9 Region: 725-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000292
Family Classic zinc finger, C2H2 0.064
Further Details:      
 
Domain Number 10 Region: 105-128,161-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000446
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 11 Region: 216-238,299-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000103
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000222339   Gene: ENSG00000105732   Transcript: ENST00000222339
Sequence length 986
Comment pep:known chromosome:GRCh38:19:42068477:42081410:1 gene:ENSG00000105732 transcript:ENST00000222339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRATWANSKERSWAESERGPRDTGNGGSKAERHIQEIETGRGGDRAKAHRRQRMRLRGT
ERASLGPGRRLGDSRGTDMPGARAQGLAAAMTEESEETVLYIEHRYVCSECNQLYGSLEE
VLMHQNSHVPQQHFELVGVADPGVTVATDTASGTGLYQTLVQESQYQCLECGQLLMSPSQ
LLEHQELHLKMMAPQEAVPAEPSPKAPPLSSSTIHYECVDCKALFASQELWLNHRQTHLR
ATPTKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVE
LLLYKCSECSQLFQLPADFLEHQATHFPAPVPESQEPALQQEVQASSPAEVPVSQPDPLP
ASDHSYELRNGEAIGRDRRGRRARRNNSGEAGGAATQELFCSACDQLFLSPHQLQQHLRS
HREGVFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAFGTEALLLAHRRAHTPNP
LHSCPCGKTFVNLTKFLYHRRTHGVGGVPLPTTPVPPEEPVIGFPEPAPAETGEPEAPEP
PVSEETSAGPAAPGTYRCLLCSREFGKALQLTRHQRFVHRLERRHKCSICGKMFKKKSHV
RNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGERPYRCGDCGKAFTQSSTLRQHR
LVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVVH
AGRQPHRCPSCGAAFPSSLRLREHRCAAAAAQAPRRFECGTCGKKVGSAARLQAHEAAHA
AAGPGEVLAKEPPAPRAPRATRAPVASPAALGSTATASPAAPARRRGLECSECKKLFSTE
TSLQVHRRIHTGERPYPCPDCGKAFRQSTHLKDHRRLHTGERPFACEVCGKAFAISMRLA
EHRRIHTGERPYSCPDCGKSYRSFSNLWKHRKTHQQQHQAAVRQQLAEAEAAVGLAVMET
AVEALPLVEAIEIYPLAEAEGVQISG
Download sequence
Identical sequences A0A0C4DFM2
XP_016882638.1.92137 ENSP00000222339 ENSP00000222339 ENSP00000222339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]