SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000225719 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000225719
Domain Number 1 Region: 498-795
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-85
Family Pancreatic carboxypeptidases 0.00000000169
Further Details:      
 
Domain Number 2 Region: 55-382
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.94e-76
Family Pancreatic carboxypeptidases 0.000000837
Further Details:      
 
Domain Number 3 Region: 929-1213
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.28e-67
Family Pancreatic carboxypeptidases 0.0000125
Further Details:      
 
Domain Number 4 Region: 795-871
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 8.04e-19
Family Carboxypeptidase regulatory domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 383-469
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 8.63e-17
Family Carboxypeptidase regulatory domain 0.00074
Further Details:      
 
Domain Number 6 Region: 1214-1312
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000235
Family Carboxypeptidase regulatory domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000225719   Gene: ENSG00000108582   Transcript: ENST00000225719
Sequence length 1380
Comment pep:known chromosome:GRCh38:17:30378905:30469989:1 gene:ENSG00000108582 transcript:ENST00000225719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRDERPPWRLGRLLLLMCLLLLGSSARAAHIKKAEATTTTTSAGAEAAEGQFDRYYH
EEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLTAGLGSLIPEGDAGPDAAGPD
AAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLP
SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRA
LIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHP
IMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPAS
QLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFY
RLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTV
AIPNILSGTSSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYV
MEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRI
HLMPSMNPDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMK
SYPFVLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPC
KNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQ
NRRSLIQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTY
KITASARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTK
EFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLG
QSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPA
VTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAII
ENLIQKQDFSLSVALDGGSMLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSC
PNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADN
KRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNII
AIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIW
CICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences O75976
ENSP00000225719 ENSP00000225719 9606.ENSP00000225719 ENSP00000225719 NP_001295.2.87134 NP_001295.2.92137 gi|22202611|ref|NP_001295.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]