SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000227135 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000227135
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000227135   Gene: ENSG00000064199   Transcript: ENST00000227135
Sequence length 151
Comment pep:putative chromosome:GRCh38:11:124673798:124694661:1 gene:ENSG00000064199 transcript:ENST00000227135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW
GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
IQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Download sequence
Identical sequences A0A172Q397 H2Q513 Q15506
NP_059121.1.87134 NP_059121.1.92137 XP_003313445.1.37143 XP_011541172.1.92137 ENSPTRP00000007569 9598.ENSPTRP00000007569 9606.ENSP00000227135 gi|8394343|ref|NP_059121.1| ENSP00000227135 ENSP00000432305 ENSP00000227135 ENSP00000227135 ENSP00000432305 GO.33830 ENSPTRP00000007569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]