SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000228799 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000228799
Domain Number 1 Region: 11-148
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000000000288
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 34-175,204-216,275-381
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000299
Family WD40-repeat 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000228799   Gene: ENSG00000111203   Transcript: ENST00000228799
Sequence length 447
Comment pep:known chromosome:GRCh38:12:2812622:2825071:1 gene:ENSG00000111203 transcript:ENST00000228799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCS
CQGMLTCVGVGDVCNKGKNLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFK
QHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLE
GQVDSLSVTLGPLGLPELMVSQPGCAYAILLCTWKKDTGSPPASEGPTDGSRETPAARDV
VLHQTSGRIHNKNVSTHLIGNIKQGHGTESSGSGLFALCTLDGTLKLMEEMEEADKLLWS
VQVDHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYAC
KEGRNSPCLVYVTFNQKIYVYWEVQLERMESTNLVKLLETKPEYHSLLQELGVDPDDLPV
TRALLHQTLYHPDQPPQCAPSSLQDPT
Download sequence
Identical sequences A0A0S2Z5P1 G2HGW5 G3R4L7 Q969R8
NP_001267257.1.37143 NP_060933.3.87134 NP_060933.3.92137 XP_004052552.2.27298 XP_016778054.1.37143 ENSP00000228799 ENSP00000228799 ENSP00000228799 gi|271397437|ref|NP_060933.3| 9606.ENSP00000228799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]