SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000233997 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000233997
Domain Number 1 Region: 17-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-61
Family Eukaryotic proteases 0.00000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000233997   Gene: ENSG00000172232   Transcript: ENST00000233997
Sequence length 251
Comment pep:known chromosome:GRCh38:19:827836:832018:1 gene:ENSG00000172232 transcript:ENST00000233997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHAR
FVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQ
LDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC
RPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWID
GVLNNPGPGPA
Download sequence
Identical sequences P20160
ENSP00000233997 gi|11342670|ref|NP_001691.1| 9606.ENSP00000233997 NP_001691.1.87134 NP_001691.1.92137 ENSP00000233997 ENSP00000479183 ENSP00000233997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]