SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000234091 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000234091
Domain Number 1 Region: 38-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000759
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000234091   Gene: ENSG00000115738   Transcript: ENST00000234091
Sequence length 134
Comment pep:known chromosome:GRCh38:2:8678845:8684453:1 gene:ENSG00000115738 transcript:ENST00000234091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
Download sequence
Identical sequences A0A0D9R3Z9 A0A2I3MZ97 A0A2J8V3T9 A0A2K5JQ93 A0A2K5LGT6 A0A2K5S0G5 A0A2K5ZYW0 A0A2K6D7B0 A0A2K6N4P3 A0A2K6NAG8 F7DNR9 G1RRW6 H0X780 I3NB28 K7B2V9 Q02363 Q4R5J7 Q53T66 Q5RCH7
9544.ENSMMUP00000004318 9600.ENSPPYP00000014197 9606.ENSP00000234091 ENSMMUP00000004318 ENSPPYP00000014197 GO.78734 HR2921 hss001000906.1 ENSNLEP00000015985 ENSOGAP00000011256 ENSP00000234091 ENSP00000379585 ENSP00000385465 NP_001125282.1.23681 NP_002157.2.87134 NP_002157.2.92137 XP_003272760.1.23891 XP_003308921.2.37143 XP_003787424.1.62490 XP_005327402.1.77405 XP_005327403.1.77405 XP_008591780.1.73410 XP_015335488.1.40921 XP_015335489.1.40921 XP_017380512.1.71028 ENSP00000234091 ENSP00000379585 ENSP00000385465 ENSP00000234091 ENSNLEP00000015985 ENSMMUP00000004318 ENSSTOP00000021575 ENSPPYP00000014197 gi|31982933|ref|NP_002157.2| ENSSTOP00000021575 ENSOGAP00000011256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]