SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000240333 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000240333
Domain Number 1 Region: 101-195
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000445
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 
Domain Number 2 Region: 252-346
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000196
Family Multidrug resistance efflux transporter EmrE 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000240333   Gene: ENSG00000121073   Transcript: ENST00000240333
Sequence length 359
Comment pep:known chromosome:GRCh38:17:49700943:49708199:-1 gene:ENSG00000121073 transcript:ENST00000240333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLPPVGDVRLELSPPPPLLPVPVVSGSPVGSSGRLMASSSSLVPDRLRLPLCFLGVFV
CYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARVDRTR
SWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLC
VLLIVAGVALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNH
MMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVY
FGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAKKTSH
Download sequence
Identical sequences A0A2J8W8Z3 G1QSE4 G3RQ62 H2QDD6
ENSGGOP00000004680 ENSGGOP00000017934 ENSGGOP00000004680 NP_005818.2.87134 NP_005818.2.92137 XP_001156965.2.37143 XP_002834323.1.23681 XP_003278820.1.23891 XP_003818085.1.60992 XP_018882597.1.27298 ENSP00000409548 ENSNLEP00000003862 ENSP00000426961 ENSP00000240333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]