SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000242462 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000242462
Domain Number 1 Region: 81-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.24e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000242462   Gene: ENSG00000122859   Transcript: ENST00000242462
Sequence length 214
Comment pep:known chromosome:GRCh38:10:69571698:69573238:-1 gene:ENSG00000122859 transcript:ENST00000242462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLLGATFSACLSPGSLAFSDFL
Download sequence
Identical sequences Q9Y4Z2
NP_066279.2.87134 NP_066279.2.92137 XP_016871769.1.92137 ENSP00000242462 gi|68989258|ref|NP_066279.2| 9606.ENSP00000242462 ENSP00000242462 ENSP00000242462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]