SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000245663 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000245663
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily POZ domain 8.24e-31
Family BTB/POZ domain 0.0004
Further Details:      
 
Domain Number 2 Region: 430-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000245663   Gene: ENSG00000130584   Transcript: ENST00000245663
Sequence length 589
Comment pep:known chromosome:GRCh38:20:63743666:63831214:-1 gene:ENSG00000130584 transcript:ENST00000245663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGG
SELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFL
PTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDA
LHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCS
RVFMSAASVGIRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPED
PRGEAEELGEDDEGLAPEDALLADDKDEEDSPRPRSPPGGPDKDFAWLS
Download sequence
Identical sequences Q86UZ6
gi|333609260|ref|NP_079500.2| ENSP00000245663 ENSP00000303102 ENSP00000378536 ENSP00000245663 ENSP00000303102 ENSP00000378536 ENSP00000245663 9606.ENSP00000245663 NP_079500.2.87134 NP_079500.2.92137 XP_005260252.1.92137 XP_005260253.1.92137 XP_005260254.1.92137 XP_005260255.1.92137 XP_006723763.1.92137 XP_011526850.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]