SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000252813 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000252813
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 1.27e-31
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000252813   Gene: ENSG00000130517   Transcript: ENST00000252813
Sequence length 132
Comment pep:putative chromosome:GRCh38:19:18340609:18364342:1 gene:ENSG00000130517 transcript:ENST00000252813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVS
VTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLE
QSEGKINYCHKH
Download sequence
Identical sequences A0A0D9QZ88 A0A2J8LT79 A0A2J8T607 A0A2K5UED9 A0A2K6QVU9
XP_005588494.1.63531 XP_005588495.1.63531 XP_010384946.1.97406 XP_011526417.1.92137 XP_011845687.1.47321 XP_014978793.1.72884 XP_016790998.1.37143 XP_016882402.1.92137 XP_017734938.1.44346 ENSP00000252813 GO.37115 ENSP00000252813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]