SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000253110 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000253110
Domain Number - Region: 109-177
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0419
Family Di-heme elbow motif 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000253110   Gene: ENSG00000130813   Transcript: ENST00000253110
Sequence length 291
Comment pep:known chromosome:GRCh38:19:10086130:10093245:1 gene:ENSG00000130813 transcript:ENST00000253110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSN
DLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWW
RRVPQRKEVSRCRKCRKRYEPVPADKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFP
VYPTRILPPRWDRDPDRRSTHTHSCSAADCYNRREPHVPGTSCAHPKSRKQNHLPKVLHP
SNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEEEVEDEEGGPRE
Download sequence
Identical sequences A0A0D9R508 A0A2K5ITC1 A0A2K5MCB9 A0A2K6L6A9 A0A2K6Q8M7 G3SE10 H2NXI0 H9FWR6 K7BTJ8 Q9NUL5
ENSP00000253110 NP_060851.2.87134 NP_060851.2.92137 XP_002828690.1.23681 XP_003809647.1.60992 XP_007993396.1.81039 XP_010372091.1.97406 XP_011810263.1.43180 XP_011949145.1.92194 XP_014978318.1.72884 XP_015295634.1.63531 XP_016790453.1.37143 XP_017735342.1.44346 XP_018870763.1.27298 ENSP00000253110 ENSPPYP00000010701 ENSP00000253110 gi|154350198|ref|NP_060851.2| ENSPPYP00000010701 9606.ENSP00000253110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]