SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000255858 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000255858
Domain Number 1 Region: 78-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-58
Family CRAL/TRIO domain 0.0000000835
Further Details:      
 
Domain Number 2 Region: 277-395
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.03e-36
Family Supernatant protein factor (SPF), C-terminal domain 0.00000191
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.09e-21
Family CRAL/TRIO N-terminal domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000255858   Gene: ENSG00000133488   Transcript: ENST00000255858
Sequence length 406
Comment pep:known chromosome:GRCh38:22:30488913:30505695:-1 gene:ENSG00000133488 transcript:ENST00000255858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHM
EFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDM
IRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEA
NYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVE
FGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPG
CVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGV
YVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ
Download sequence
Identical sequences B2RMR2 Q9UDX3
NP_777637.1.87134 NP_777637.1.92137 ENSP00000255858 ENSP00000255858 ENSP00000255858 9606.ENSP00000255858 gi|28376621|ref|NP_777637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]