SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000259512 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000259512
Domain Number 1 Region: 9-191
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000301
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000259512   Gene: ENSG00000136986   Transcript: ENST00000259512
Sequence length 251
Comment pep:known chromosome:GRCh38:8:123013164:123042423:-1 gene:ENSG00000136986 transcript:ENST00000259512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF
YFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
Download sequence
Identical sequences A0A024R9G3 A0A2K6F8X3 G1QZD6 G3R0M4 H2QWN4 Q9BUN8
ENSNLEP00000006307 9598.ENSPTRP00000035139 9606.ENSP00000259512 ENSPTRP00000035139 ENSPTRP00000035139 ENSP00000259512 ENSP00000259512 gi|13236516|ref|NP_077271.1| ENSP00000384289 NP_077271.1.87134 NP_077271.1.92137 XP_003256215.1.23891 XP_003820537.1.60992 XP_004047532.1.27298 XP_012516297.1.63892 XP_012598764.1.48125 XP_519933.1.37143 ENSNLEP00000006307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]