SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261267 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261267
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 5.9e-55
Family C-type lysozyme 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261267   Gene: ENSG00000090382   Transcript: ENST00000261267
Sequence length 148
Comment pep:known chromosome:GRCh38:12:69348341:69354234:1 gene:ENSG00000090382 transcript:ENST00000261267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
Download sequence
Identical sequences A0A2J8K4P0 B2R4C5 P61626 P61627 P61628
ENSP00000261267 NP_000230.1.87134 NP_000230.1.92137 NP_001009073.1.37143 XP_003808770.1.60992 9606.ENSP00000261267 ENSP00000261267 ENSP00000261267 gi|4557894|ref|NP_000230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]