SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261772 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261772
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.73e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000044
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.7e-62
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000153
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.49e-39
Family AlaX-like 0.034
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000109
Family AlaX-M N-terminal domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261772   Gene: ENSG00000090861   Transcript: ENST00000261772
Sequence length 968
Comment pep:known chromosome:GRCh38:16:70252295:70289543:-1 gene:ENSG00000090861 transcript:ENST00000261772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEV
TDDSPKYNYHLDSSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences P49588
gi|109148542|ref|NP_001596.2| ENSP00000261772 ENSP00000261772 ENSP00000261772 NP_001596.2.87134 NP_001596.2.92137 9606.ENSP00000261772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]