SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262225 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262225
Domain Number 1 Region: 28-116
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.27e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSP00000262225
Domain Number - Region: 124-184
Classification Level Classification E-value
Superfamily MTH1598-like 0.0732
Family MTH1598-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262225   Gene: ENSG00000086598   Transcript: ENST00000262225
Sequence length 201
Comment pep:known chromosome:GRCh38:12:123584531:123598577:1 gene:ENSG00000086598 transcript:ENST00000262225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQD
METEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL
VAMTLGQIYYLKRFFEVRRVV
Download sequence
Identical sequences A0A2I3LEI5 A0A2K5MVF4 A0A2K6DBC1 A0A2K6M1Y3 A0A2K6R836 D2GVZ9 G3SGK8 H2NJ20 H9EPG4 K7CXC4 Q15363 Q4R5D1 Q6FHT8
ENSP00000262225 NP_001271659.1.63531 NP_006806.1.87134 NP_006806.1.92137 XP_002913147.1.58354 XP_003778202.1.23681 XP_003812145.1.60992 XP_008003317.1.81039 XP_008589583.1.73410 XP_009424809.1.37143 XP_010366700.1.97406 XP_011760285.1.29376 XP_011926772.1.92194 XP_014965112.1.72884 XP_017745325.1.44346 XP_017916855.1.57651 XP_018894006.1.27298 Hs5803149___KOG1692 NYSGRC-5803149 ENSP00000262225 ENSPPYP00000005797 gi|5803149|ref|NP_006806.1| ENSAMEP00000016091 9598.ENSPTRP00000009524 9600.ENSPPYP00000005797 9606.ENSP00000262225 ENSAMEP00000016091 ENSP00000262225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]