SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000264651 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264651
Domain Number 1 Region: 373-451
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.93e-22
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 138-173
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000204
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 255-371
Classification Level Classification E-value
Superfamily Prefoldin 0.000016
Family Prefoldin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264651   Gene: ENSG00000167916   Transcript: ENST00000264651
Sequence length 525
Comment pep:known chromosome:GRCh38:17:40697991:40703750:-1 gene:ENSG00000167916 transcript:ENST00000264651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAF
GGSFGGGFGSCSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFY
SYGGGMGGGVGDGGLFSGGEKQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYG
PGSGDGGSGRDYSKYYSIIEDLRNQIIAATVENAGIILHIDNARLAADDFRLKYENELCL
RQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLRKNHEEEMKNMQGSSGGEVTV
EMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTDAGAATSAKNE
ITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGD
SRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
Download sequence
Identical sequences Q2M2I5
ENSP00000264651 gi|192807292|ref|NP_061889.2| NP_061889.2.87134 NP_061889.2.92137 9606.ENSP00000264651 ENSP00000264651 ENSP00000264651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]