SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000264717 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264717
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 3.71e-19
Family mono-SIS domain 0.0072
Further Details:      
 
Domain Number 2 Region: 29-278
Classification Level Classification E-value
Superfamily SIS domain 0.0000000389
Family mono-SIS domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264717   Gene: ENSG00000084734   Transcript: ENST00000264717
Sequence length 625
Comment pep:known chromosome:GRCh38:2:27496842:27523684:1 gene:ENSG00000084734 transcript:ENST00000264717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEI
FQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
KAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFE
RAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ
TIVEQVKEKTNHIQALAHSTVGQTLLIPLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLR
AIHFPQPLSDDIRAAPISCHVQVAHEKEQVIPIALLSLLFRCSITEAQAHLAAAPSVCEA
VRSALAGPGQKRTADPLEILEPDVQ
Download sequence
Identical sequences A0A0C4DFN2
gi|221625433|ref|NP_001477.2| ENSP00000264717 9606.ENSP00000264717 ENSP00000264717 NP_001477.2.87134 NP_001477.2.92137 ENSP00000264717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]