SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000265417 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265417
Domain Number 1 Region: 280-367
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000446
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 170-279
Classification Level Classification E-value
Superfamily SEA domain 0.0000000745
Family SEA domain 0.0068
Further Details:      
 
Domain Number 3 Region: 473-552
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000159
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 
Weak hits

Sequence:  ENSP00000265417
Domain Number - Region: 975-1295
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000265
Family Rhodopsin-like 0.036
Further Details:      
 
Domain Number - Region: 383-466
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0176
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265417   Gene: ENSG00000069122   Transcript: ENST00000265417
Sequence length 1346
Comment pep:known chromosome:GRCh38:6:46852599:46954943:-1 gene:ENSG00000069122 transcript:ENST00000265417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSLHEHEPAGEEALRQKRAVATKSPTA
EEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWC
SCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNV
GFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPS
LELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSS
NVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVCKLILDIFEYE
CKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDI
DSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPI
SVSEGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWN
GTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKV
TFHTGSSSLPAAKEVNKKQVCYKHNFNASSVSWCSKTVDVCCHFTNAANNSVWSPSMKLN
LVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPESPIGGTITYKCVGSQWEEKRNDC
ISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLL
STVPTQVNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD
SPPLSFSQTNVQMSSMVIKSSHPETYQQRFVFPYFDLWGNVVIDKSYLENLQSDSSIVTM
AFPTLQAILAQDIQENNFAESLVMTTTVSHNTTMPFRISMTFKNNSPSGGETKCVFWNFR
LANNTGGWDSSGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGV
GFSILSLAACLVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYI
LCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPL
AISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITITIVVITKILRP
SIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKT
GTYNVSTPEATSSSLENSSSASSLLN
Download sequence
Identical sequences Q8IZF2
9606.ENSP00000265417 ENSP00000265417 ENSP00000283296 ENSP00000265417 ENSP00000283296 gi|148719671|ref|NP_001091988.1| gi|148719673|ref|NP_056049.4| NP_001091988.1.87134 NP_001091988.1.92137 NP_056049.4.87134 NP_056049.4.92137 ENSP00000265417 NYSGRC-IgSF-GP116_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]