SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000266456 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000266456
Domain Number 1 Region: 53-199
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-35
Family C-type lectin domain 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000266456   Gene: ENSG00000172243   Transcript: ENST00000353231
Sequence length 201
Comment pep:known chromosome:GRCh38:12:10116777:10130241:-1 gene:ENSG00000172243 transcript:ENST00000353231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVI
AVVLGTMGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGF
IVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVS
VIYDQLCSVPSYSICEKKFSM
Download sequence
Identical sequences ENSP00000266456 gi|13384604|ref|NP_072092.2| ENSP00000266456 NP_072092.2.87134 NP_072092.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]