SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000266673 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000266673
Domain Number - Region: 19-91
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0275
Family Rhomboid-like 0.021
Further Details:      
 
Domain Number - Region: 90-130
Classification Level Classification E-value
Superfamily FLJ32549 domain-like 0.0366
Family FLJ32549 domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000266673   Gene: ENSG00000139291   Transcript: ENST00000266673
Sequence length 336
Comment pep:known chromosome:GRCh38:12:71686087:71705046:1 gene:ENSG00000139291 transcript:ENST00000266673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLNDNICKRYIKMITNIVILSLIICISLAFWIISMTASTYYGNLRPISPWRWLFSVVV
PVLIVSNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEVKKR
LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL
ACSAGDTWASEVGPVLSKSSPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT
QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGLDESTGMVVNSPTNKAR
HIAGKPILDNNAVNLFSSVLIALLLPTAAWGFWPRG
Download sequence
Identical sequences A0A024RBA1 Q96HH6
9606.ENSP00000266673 gi|21361720|ref|NP_060749.2| ENSP00000266673 NP_060749.2.87134 NP_060749.2.92137 ENSP00000266673 ENSP00000266673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]