SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000266712 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000266712
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily TPR-like 5.88e-33
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 660-801
Classification Level Classification E-value
Superfamily TPR-like 1.84e-21
Family Tetratricopeptide repeat (TPR) 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSP00000266712
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0296
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000266712   Gene: ENSG00000139324   Transcript: ENST00000266712
Sequence length 914
Comment pep:known chromosome:GRCh38:12:88142296:88199887:1 gene:ENSG00000139324 transcript:ENST00000266712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSS
VIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIIWTPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSIRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSY
INEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELK
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKISSSSFIEPIFPTSKISSVEGKK
IPTESVKEIRGESRQTQIVKTSDNKSQSKSNKQLGKNGDEETPHKTTKDIKEIEKKRVAA
LKRLEEIERILNGE
Download sequence
Identical sequences ENSP00000266712 ENSP00000266712 gi|224809432|ref|NP_861448.2| ENSP00000266712 NP_861448.2.87134 NP_861448.2.92137 9606.ENSP00000266712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]