SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000268296 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000268296
Domain Number 1 Region: 20-126,313-617
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.09e-64
Family Integrin alpha N-terminal domain 0.0000653
Further Details:      
 
Domain Number 2 Region: 108-335
Classification Level Classification E-value
Superfamily vWA-like 4.77e-50
Family Integrin A (or I) domain 0.0000000169
Further Details:      
 
Domain Number 3 Region: 617-772
Classification Level Classification E-value
Superfamily Integrin domains 3.92e-30
Family Integrin domains 0.0062
Further Details:      
 
Domain Number 4 Region: 774-919
Classification Level Classification E-value
Superfamily Integrin domains 4.19e-29
Family Integrin domains 0.0043
Further Details:      
 
Domain Number 5 Region: 950-1093
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000366
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000268296   Gene: ENSG00000140678   Transcript: ENST00000268296
Sequence length 1163
Comment pep:known chromosome:GRCh38:16:31355134:31382997:1 gene:ENSG00000140678 transcript:ENST00000268296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK
Download sequence
Identical sequences P20702
9606.ENSP00000268296 ENSP00000268296 gi|34452173|ref|NP_000878.2| NP_000878.2.87134 NP_000878.2.92137 ENSP00000268296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]