SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000268676 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000268676
Domain Number 1 Region: 192-251
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000268676
Domain Number - Region: 231-240,272-291,441-492
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00176
Family Cytochrome c3-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000268676   Gene: ENSG00000140995   Transcript: ENST00000268676
Sequence length 512
Comment pep:known chromosome:GRCh38:16:89948775:89968060:1 gene:ENSG00000140995 transcript:ENST00000268676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILSLRAPGPWQAMQVWADRTLLTPHTGVTSQVLGVAAAVMTPLPGGHAAGRTREARWD
AMEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPER
VMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLK
LQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHS
KCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYT
GQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFSY
VEELVEIRKLRQDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAG
RLGCSLTEIHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRD
CYYDNSTTCPKCARLSLRKQSLFQEPGPDVEA
Download sequence
Identical sequences Q6ZN54
ENSP00000268676 NP_997397.1.87134 NP_997397.1.92137 XP_016878852.1.92137 9606.ENSP00000268676 NYSGRC-46447820 ENSP00000268676 ENSP00000268676 gi|46447820|ref|NP_997397.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]