SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000269919 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000269919
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 2.35e-60
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000269919   Gene: ENSG00000130517   Transcript: ENST00000269919
Sequence length 209
Comment pep:known chromosome:GRCh38:19:18340587:18369950:1 gene:ENSG00000130517 transcript:ENST00000269919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPA
LWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQ
LGRALRAIIEEMLDLLEQSEGKINYCHKH
Download sequence
Identical sequences A0A2I3HNV5 G3RNX9 H2NY33 H2QFT0 Q9NXJ5
NP_060182.1.87134 NP_060182.1.92137 XP_001162684.1.37143 XP_002828971.1.23681 XP_003275873.1.23891 XP_003817823.1.60992 XP_018872048.1.27298 ENSPTRP00000018263 ENSPPYP00000010910 ENSP00000252813 ENSNLEP00000007280 ENSNLEP00000007280 ENSP00000269919 ENSPPYP00000010910 9598.ENSPTRP00000018263 9600.ENSPPYP00000010910 9606.ENSP00000252813 ENSP00000269919 gi|8923198|ref|NP_060182.1| ENSPTRP00000018263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]