SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000274134 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000274134
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000274134   Gene: ENSG00000145491   Transcript: ENST00000274134
Sequence length 230
Comment pep:known chromosome:GRCh38:5:10441876:10465028:1 gene:ENSG00000145491 transcript:ENST00000274134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDR
MEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPC
ENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDS
DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH
Download sequence
Identical sequences Q96C74
gi|17572807|ref|NP_114122.2| gi|319890246|ref|NP_001188395.1| ENSP00000274134 ENSP00000421405 ENSP00000274134 ENSP00000421405 9606.ENSP00000274134 ENSP00000274134 NP_001188395.1.87134 NP_001188395.1.92137 NP_114122.2.87134 NP_114122.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]