SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000277541 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000277541
Domain Number 1 Region: 1872-2116
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-53
Family Ankyrin repeat 0.0000000601
Further Details:      
 
Domain Number 2 Region: 439-570
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 1170-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000014
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000118
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 288-456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 8 Region: 791-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000124
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 10 Region: 141-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000652
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 983-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000149
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 1146-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000354
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 563-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000511
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 14 Region: 257-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000634
Family EGF-type module 0.02
Further Details:      
 
Domain Number 15 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 16 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000775
Family EGF-type module 0.026
Further Details:      
 
Domain Number 17 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000116
Family Notch domain 0.0052
Further Details:      
 
Domain Number 18 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1529-1561
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0043
Further Details:      
 
Domain Number 20 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 21 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000504
Family EGF-type module 0.013
Further Details:      
 
Domain Number 22 Region: 1391-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.02
Further Details:      
 
Domain Number 23 Region: 1114-1146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000177
Family EGF-type module 0.02
Further Details:      
 
Domain Number 24 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.00017
Further Details:      
 
Domain Number 25 Region: 1345-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000733
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSP00000277541
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00409
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000277541   Gene: ENSG00000148400   Transcript: ENST00000277541
Sequence length 2555
Comment pep:known chromosome:GRCh38:9:136494444:136545862:-1 gene:ENSG00000148400 transcript:ENST00000277541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYY
GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA
AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP
TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVAS
GTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA
NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQE
SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Download sequence
Identical sequences P46531
NP_060087.3.87134 NP_060087.3.92137 ENSP00000277541 gi|148833508|ref|NP_060087.3| ENSP00000277541 ENSP00000277541 9606.ENSP00000277541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]