SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000280362 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000280362
Domain Number 1 Region: 13-145
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 8.89e-49
Family 6-pyruvoyl tetrahydropterin synthase 0.000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000280362   Gene: ENSG00000150787   Transcript: ENST00000280362
Sequence length 145
Comment pep:known chromosome:GRCh38:11:112226365:112233973:1 gene:ENSG00000150787 transcript:ENST00000280362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVH
GEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQK
VLPVGVLYKVKVYETDNNIVVYKGE
Download sequence
Identical sequences Q03393
gi|4506331|ref|NP_000308.1| ENSP00000280362 NP_000308.1.87134 NP_000308.1.92137 9606.ENSP00000280362 ENSP00000280362 ENSP00000280362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]