SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000282588 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282588
Domain Number 1 Region: 29-148,339-664
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.22e-73
Family Integrin alpha N-terminal domain 0.0000563
Further Details:      
 
Domain Number 2 Region: 167-360
Classification Level Classification E-value
Superfamily vWA-like 3.56e-52
Family Integrin A (or I) domain 0.0000000115
Further Details:      
 
Domain Number 3 Region: 667-810
Classification Level Classification E-value
Superfamily Integrin domains 2.09e-33
Family Integrin domains 0.00091
Further Details:      
 
Domain Number 4 Region: 813-939
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-22
Family Integrin domains 0.01
Further Details:      
 
Domain Number 5 Region: 945-1145
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-20
Family Integrin domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282588   Gene: ENSG00000213949   Transcript: ENST00000282588
Sequence length 1179
Comment pep:known chromosome:GRCh38:5:52787896:52959210:1 gene:ENSG00000213949 transcript:ENST00000282588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTTDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTTENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDIS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences P56199
ENSP00000282588 NYSGRC-31657142 ENSP00000282588 gi|31657142|ref|NP_852478.1| NP_852478.1.87134 NP_852478.1.92137 9606.ENSP00000282588 ENSP00000282588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]