SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000282878 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282878
Domain Number 1 Region: 26-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-59
Family G proteins 0.0000000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282878   Gene: ENSG00000152932   Transcript: ENST00000282878
Sequence length 227
Comment pep:known chromosome:GRCh38:5:58583040:58859394:1 gene:ENSG00000152932 transcript:ENST00000282878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFV
STVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNA
VQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINV
KQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC
Download sequence
Identical sequences A0A096MNX8 A0A2K5JPY8 A0A2K6BII3 A0A2K6MVQ9 F7CYU0 G3RCG9 G7P7K2 H2PFL9 H2QQY1 M3ZBG8 Q96E17
ENSP00000282878 ENSPANP00000001402 ENSPPYP00000017302 ENSP00000282878 ENSPTRP00000028939 ENSMMUP00000006854 ENSNLEP00000003126 ENSPPYP00000017302 NP_001252924.1.72884 NP_612462.1.87134 NP_612462.1.92137 XP_002815628.1.23681 XP_003266004.1.23891 XP_004058859.2.27298 XP_005557008.1.63531 XP_007971463.1.81039 XP_011770281.1.29376 XP_011798294.1.43180 XP_017729723.1.44346 XP_526915.3.37143 gi|19923985|ref|NP_612462.1| ENSNLEP00000003126 ENSPTRP00000028939 9544.ENSMMUP00000006854 9598.ENSPTRP00000028939 9600.ENSPPYP00000017302 9606.ENSP00000282878 ENSMMUP00000006854 ENSP00000282878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]