SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000282999 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282999
Domain Number 1 Region: 7-101
Classification Level Classification E-value
Superfamily SRP19 3.14e-34
Family SRP19 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282999   Gene: ENSG00000153037   Transcript: ENST00000282999
Sequence length 110
Comment pep:putative chromosome:GRCh38:5:112861305:112867935:1 gene:ENSG00000153037 transcript:ENST00000282999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSHYTLSLTSGS
Download sequence
Identical sequences A0A096NQR6 A0A2I3HU51 A0A2J8XEM9 A0A2K5E8V4 A0A2K5K1K0 A0A2K5LIF1 A0A2K5TPZ6 A0A2K6D3U2 A0A2K6G7V5 A0A2K6JWG7 A0A2K6PU50
NP_001191122.1.87134 NP_001191122.1.92137 XP_003259880.1.23891 XP_005557578.1.63531 XP_008012344.1.81039 XP_008950326.1.60992 XP_009447686.1.37143 XP_010374117.1.97406 XP_011819030.1.43180 XP_011925905.1.92194 XP_014996075.1.72884 XP_017382675.1.71028 gi|323510696|ref|NP_001191122.1| ENSP00000282999 ENSP00000282999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]