SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000285333 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000285333
Domain Number 1 Region: 14-201
Classification Level Classification E-value
Superfamily Caspase-like 1.2e-63
Family Caspase catalytic domain 0.00000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000285333   Gene: ENSG00000138794   Transcript: ENST00000352981
Sequence length 204
Comment pep:known chromosome:GRCh38:4:109688622:109703419:-1 gene:ENSG00000138794 transcript:ENST00000352981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSASGLRRGHPAVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCH
SLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMC
YSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSA
IGKKQVPCFASMLTKKLHFFPKSN
Download sequence
Identical sequences ENSP00000285333 NP_116787.1.87134 NP_116787.1.92137 gi|14916485|ref|NP_116787.1| ENSP00000285333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]