SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000287497 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000287497
Domain Number 1 Region: 17-123,312-616
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.11e-69
Family Integrin alpha N-terminal domain 0.0000622
Further Details:      
 
Domain Number 2 Region: 144-334
Classification Level Classification E-value
Superfamily vWA-like 1.53e-49
Family Integrin A (or I) domain 0.00000000767
Further Details:      
 
Domain Number 3 Region: 773-920
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-33
Family Integrin domains 0.0026
Further Details:      
 
Domain Number 4 Region: 616-772
Classification Level Classification E-value
Superfamily Integrin domains 3.56e-29
Family Integrin domains 0.0093
Further Details:      
 
Domain Number 5 Region: 950-1090
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000105
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000287497   Gene: ENSG00000169896   Transcript: ENST00000287497
Sequence length 1152
Comment pep:known chromosome:GRCh38:16:31259990:31331768:1 gene:ENSG00000169896 transcript:ENST00000287497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
Download sequence
Identical sequences P11215
gi|88501734|ref|NP_000623.2| ENSP00000287497 ENSP00000287497 NP_000623.2.87134 NP_000623.2.92137 9606.ENSP00000287497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]