SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000288025 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000288025
Domain Number - Region: 47-147
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000654
Family Supernatant protein factor (SPF), C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000288025   Gene: ENSG00000157315   Transcript: ENST00000288025
Sequence length 240
Comment pep:known chromosome:GRCh38:16:69343248:69351809:-1 gene:ENSG00000157315 transcript:ENST00000288025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFA
HQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCL
SNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYY
NFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC
Download sequence
Identical sequences Q8WW62
ENSP00000288025 ENSP00000288025 NP_653277.2.87134 NP_653277.2.92137 ENSP00000288025 gi|269914167|ref|NP_653277.2| 9606.ENSP00000288025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]