SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000289820 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000289820
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.7e-33
Family Nucleoplasmin-like core domain 0.0000608
Further Details:      
 
Weak hits

Sequence:  ENSP00000289820
Domain Number - Region: 122-161
Classification Level Classification E-value
Superfamily ARM repeat 0.0118
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000289820   Gene: ENSG00000158806   Transcript: ENST00000289820
Sequence length 214
Comment pep:putative chromosome:GRCh38:8:22024843:22036897:1 gene:ENSG00000158806 transcript:ENST00000289820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMH
RVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQER
YEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKK
LEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Download sequence
Identical sequences Q86SE8
9606.ENSP00000289820 NP_001273609.1.87134 NP_001273609.1.92137 NP_877724.1.87134 NP_877724.1.92137 XP_011542664.1.92137 XP_011542665.1.92137 XP_016868437.1.92137 XP_016868438.1.92137 ENSP00000289820 ENSP00000381032 ENSP00000427741 ENSP00000429413 ENSP00000481077 ENSP00000289820 GO.81822 gi|33391150|ref|NP_877724.1| ENSP00000289820 ENSP00000381032 ENSP00000427741 ENSP00000429413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]