SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000293230 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000293230
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 2.17e-43
Family Globins 0.0000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000293230   Gene: ENSG00000161544   Transcript: ENST00000293230
Sequence length 190
Comment pep:known chromosome:GRCh38:17:76527356:76537905:-1 gene:ENSG00000161544 transcript:ENST00000293230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Download sequence
Identical sequences A0A1K0FUB6 K7AH89 Q8WWM9
ENSP00000293230 ENSP00000293230 gi|19549331|ref|NP_599030.1| 9606.ENSP00000293230 NP_599030.1.87134 NP_599030.1.92137 XP_003953243.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]