SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000297044 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000297044
Domain Number 1 Region: 63-256
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-79
Family Sec7 domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 264-385
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-34
Family Pleckstrin-homology domain (PH domain) 0.000000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000297044   Gene: ENSG00000008256   Transcript: ENST00000350796
Sequence length 399
Comment pep:known chromosome:GRCh38:7:6161776:6272644:-1 gene:ENSG00000008256 transcript:ENST00000350796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences A0A0D9RYP9 A0A2K5KTX7 A0A2K5Q513 A0A2K5TST9 A0A2K6BVL9 G1QKE0 H2PLF5 H2QU58 I0FH74
gi|4758968|ref|NP_004218.1| ENSPTRP00000032293 ENSPANP00000015177 ENSPTRP00000032293 9600.ENSPPYP00000019437 9606.ENSP00000297044 ENSNLEP00000001385 ENSP00000297044 ENSPPYP00000019437 ENSPPYP00000023595 ENSPPYP00000019437 NP_001238790.1.37143 NP_004218.1.87134 NP_004218.1.92137 XP_001109483.3.72884 XP_003281960.1.23891 XP_005549139.1.63531 XP_011767760.1.29376 XP_011767769.1.29376 XP_011912403.1.92194 XP_011912404.1.92194 XP_014988751.1.72884 XP_015302556.1.63531 XP_015302557.1.63531 XP_016801508.1.37143 XP_017389232.1.71028 ENSP00000297044 ENSP00000297044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]