SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000299633 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299633
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.79e-32
Family PWWP domain 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299633   Gene: ENSG00000166503   Transcript: ENST00000299633
Sequence length 203
Comment pep:known chromosome:GRCh38:15:83127753:83208018:-1 gene:ENSG00000166503 transcript:ENST00000299633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPK
DLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADA
SSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSS
EGGDAGNDTRNTTSDLQKTSEGT
Download sequence
Identical sequences A0A024R216 A0A096NN03 A0A0D9RXJ7 A0A287AQQ1 A0A2J8SGE2 A0A2K5CS82 A0A2K5M195 A0A2K5RES9 A0A2K5WIA1 A0A2K6B651 A0A2K6G8X4 A0A2K6RCV6 F7IPD3 G1RIX8 H2Q9Z9 H9FV36 Q9Y3E1
ENSPTRP00000012627 ENSP00000299633 ENSCJAP00000029081 gi|7705320|ref|NP_057157.1| ENSP00000299633 ENSPANP00000014363 ENSPTRP00000012627 9598.ENSPTRP00000012627 9606.ENSP00000299633 ENSNLEP00000013185 ENSCJAP00000029081 ENSNLEP00000013185 ENSP00000299633 NP_057157.1.87134 NP_057157.1.92137 XP_001149122.2.37143 XP_002749229.1.60252 XP_003268498.1.23891 XP_004432050.1.5094 XP_005560358.1.63531 XP_007129890.1.24612 XP_007470128.1.90284 XP_007943295.1.48129 XP_007988417.1.81039 XP_010359122.1.97406 XP_011766887.1.29376 XP_011947439.1.92194 XP_012304847.1.9421 XP_012391646.1.21590 XP_012511989.1.63892 XP_012618662.1.48125 XP_014998377.1.72884 XP_017357748.1.71028 XP_019801446.1.83887 XP_020954540.1.46622 XP_021536264.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]