SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000299705 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299705
Domain Number 1 Region: 37-128
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.57e-21
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299705   Gene: ENSG00000166557   Transcript: ENST00000299705
Sequence length 217
Comment pep:known chromosome:GRCh38:15:79311062:79322847:1 gene:ENSG00000166557 transcript:ENST00000299705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITG
GHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQV
GDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVS
YWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
Download sequence
Identical sequences A0A140VKD1 Q9Y3Q3
9606.ENSP00000299705 gi|6679189|ref|NP_031390.1| ENSP00000299705 ENSP00000299705 1302 NP_031390.1.87134 NP_031390.1.92137 ENSP00000299705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]