SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000301407 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301407
Domain Number 1 Region: 23-128
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.21e-36
Family Gonadodropin/Follitropin 0.000000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301407   Gene: ENSG00000267631   Transcript: ENST00000301407
Sequence length 155
Comment pep:known chromosome:GRCh38:19:49035610:49036816:-1 gene:ENSG00000267631 transcript:ENST00000301407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMT
RVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGG
PKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP
Download sequence
Identical sequences ENSP00000301407 NP_203695.2.87134 NP_203695.2.92137 9606.ENSP00000301407 gi|132566537|ref|NP_203695.2| ENSP00000301407 ENSP00000301407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]