SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000301633 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301633
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.83e-25
Family Inhibitor of apoptosis (IAP) repeat 0.00000652
Further Details:      
 
Domain Number 2 Region: 97-153
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0000785
Family Inhibitor of apoptosis (IAP) repeat 0.000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301633   Gene: ENSG00000089685   Transcript: ENST00000301633
Sequence length 165
Comment pep:known chromosome:GRCh38:17:78214186:78225636:1 gene:ENSG00000089685 transcript:ENST00000301633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIGPGTVAYACNTSTLGGRGGRITREEHKKHSSGCAFLSVKKQFEELT
LGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD
Download sequence
Identical sequences H3BLT4
NP_001012271.1.87134 NP_001012271.1.92137 gi|59859882|ref|NP_001012271.1| 9606.ENSP00000301633 ENSP00000324180 ENSP00000301633 ENSP00000301633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]