SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000302222 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000302222
Domain Number 1 Region: 239-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 295-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 183-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 127-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 101-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000126
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000302222   Gene: ENSG00000175395   Transcript: ENST00000302609
Sequence length 456
Comment pep:known chromosome:GRCh38:10:37949572:37976633:-1 gene:ENSG00000175395 transcript:ENST00000302609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFQGPVTLKDVIVEFTKEEWKLLTPAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKL
KQGKEPWILEVEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTHTTEKACEC
KECGKFFCQKSALIVHQHTHSKGKSYDCDKCGKSFSKNEDLIRHQKIHTRDKTYECKECK
KIFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLTEHQKTHTGEKPFECTECGKFFY
VKAYLMVHQKTHTGEKPYECKECGKAFSQKSHLTVHQRMHTGEKPYKCKECGKFFSRNSH
LKTHQRSHTGEKPYECKECRKCFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKH
QRKHTGEKPYECTECGKSFAVNSVLRLHQRTHTGEKPYACKECGKSFSQKSHFIIHQRKH
TGEKPYECQECGETFIQKSQLTAHQKTHTKKRNAEK
Download sequence
Identical sequences P17030
ENSP00000302222 ENSP00000302222 gi|21918844|ref|NP_659448.1| NP_659448.1.87134 NP_659448.1.92137 XP_005252441.1.92137 XP_005252442.1.92137 XP_005252443.1.92137 ENSP00000302222 9606.ENSP00000302222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]