SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000303554 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000303554
Domain Number 1 Region: 280-566
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.63e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000268
Further Details:      
 
Domain Number 2 Region: 77-252
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 3 Region: 3-72
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000000432
Family CRAL/TRIO N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000303554   Gene: ENSG00000169410   Transcript: ENST00000306726
Sequence length 583
Comment pep:known chromosome:GRCh38:15:75467127:75579289:-1 gene:ENSG00000169410 transcript:ENST00000306726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLRAIELFHSYRE
TRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPHKSVQHVVLQA
LFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVG
APIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVKIDLATWNFQF
LPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDI
RRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKN
AYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLT
VTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQ
QSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRM
RTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ
Download sequence
Identical sequences A0A0A0MR09 A0A2J8KS93 A0A2J8UDQ7
ENSP00000303554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]