SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000303915 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000303915
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 37-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-21
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 5 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 196-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000111
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000779
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSP00000303915
Domain Number - Region: 107-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000411
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000303915   Gene: ENSG00000171469   Transcript: ENST00000302851
Sequence length 486
Comment pep:known chromosome:GRCh38:19:9607332:9621399:-1 gene:ENSG00000171469 transcript:ENST00000302851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIYLSRGFFSREPICPFEEKTKVERMVEDYLASGYQDSVTFDDVAVDFTPEEWALLDT
TEKYLYRDVMLENYMNLASVEWEIQPRTKRSSLQQGFLKNQIFSGIQMTRGYSGWKLCDC
KNCGEVFREQFCLKTHMRVQNGGNTSEGNCYGKDTLSVHKEASTGQELSKFNPCGKVFTL
TPGLAVHLEVLNARQPYKCKECGKGFKYFASLDNHMGIHTDEKLCEFQEYGRAVTASSHL
KQCVAVHTGKKSKKTKKCGKSFTNFSQLYAPVKTHKGEKSFECKECGRSFRNSSCLNDHI
QIHTGIKPHKCTYCGKAFTRSTQLTEHVRTHTGIKPYECKECGQAFAQYSGLSIHIRSHS
GKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRRSKHLKTHSGEKP
FVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKECGKAFAVSSRLSRHERIHTGEKPYECK
DMSVTI
Download sequence
Identical sequences Q8N587
9606.ENSP00000303915 gi|206725458|ref|NP_689502.2| ENSP00000346687 ENSP00000303915 NP_689502.2.87134 NP_689502.2.92137 XP_005260207.1.92137 ENSP00000303915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]